TSPAN6 (Human) Recombinant Protein (Q01)
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TSPAN6 partial ORF ( AAH12389, 115 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
RHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.08
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TSPAN6
Entrez GeneID
7105GeneBank Accession#
BC012389Protein Accession#
AAH12389Gene Name
TSPAN6
Gene Alias
T245, TM4SF6, TSPAN-6
Gene Description
tetraspanin 6
Omim ID
300191Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq
Other Designations
A15 homolog|OTTHUMP00000023652|tetraspan TM4SF|tetraspanin TM4-D|transmembrane 4 superfamily member 6
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com