SMARCD2 monoclonal antibody (M03), clone 2C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SMARCD2.
Immunogen
SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.21 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SMARCD2 monoclonal antibody (M03), clone 2C2. Western Blot analysis of SMARCD2 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
SMARCD2 monoclonal antibody (M03), clone 2C2. Western Blot analysis of SMARCD2 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
SMARCD2 monoclonal antibody (M03), clone 2C2. Western Blot analysis of SMARCD2 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
SMARCD2 monoclonal antibody (M03), clone 2C2 Western Blot analysis of SMARCD2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — SMARCD2
Entrez GeneID
6603GeneBank Accession#
NM_003077Protein Accession#
NP_003068Gene Name
SMARCD2
Gene Alias
BAF60B, CRACD2, PRO2451, Rsc6p
Gene Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
Omim ID
601736Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
SWI/SNF complex 60 kDa subunit B|SWI/SNF-related matrix-associated actin-dependent regulator of chromatin d2|Swp73-like protein|chromatin remodeling complex BAF60B subunit|mammalian chromatin remodeling complex BRG1-associated factor 60B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com