BRD2 monoclonal antibody (M01), clone 3D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BRD2.
Immunogen
BRD2 (NP_005095, 167 a.a. ~ 256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BRD2 monoclonal antibody (M01), clone 3D10. Western Blot analysis of BRD2 expression in Hela S3 NE(Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BRD2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — BRD2
Entrez GeneID
6046GeneBank Accession#
NM_005104Protein Accession#
NP_005095Gene Name
BRD2
Gene Alias
D6S113E, DKFZp686N0336, FLJ31942, FSH, FSRG1, KIAA9001, NAT, RING3, RNF3
Gene Description
bromodomain containing 2
Omim ID
601540Gene Ontology
HyperlinkGene Summary
This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene, but the full-length nature of some of these variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000029350|bromodomain-containing 2|female sterile homeotic-related gene 1
-
Interactome
-
Disease
-
Publication Reference
-
The TGFβ→TAK1→LATS→YAP1 Pathway Regulates the Spatiotemporal Dynamics of YAP1.
Min-Kyu Kim, Sang-Hyun Han, Tae-Geun Park, Soo-Hyun Song, Ja-Youl Lee, You-Soub Lee, Seo-Yeong Yoo, Xin-Zi Chi, Eung-Gook Kim, Ju-Won Jang, Dae Sik Lim, Andre J van Wijnen, Jung-Won Lee, Suk-Chul Bae.
Molecules and Cells 2023 Oct; 46(10):592.
Application:WB, Human, HEK293T, MKN28, PANC1, WI-38 cells.
-
A Point Mutation R122C in RUNX3 Promotes the Expansion of Isthmus Stem Cells and Inhibits Their Differentiation in the Stomach.
Daisuke Douchi, Akihiro Yamamura, Junichi Matsuo, Jung-Won Lee, Napat Nuttonmanit, Yi Hui Melissa Lim, Kazuto Suda, Mitsuhiro Shimura, Sabirah Chen, ShuChin Pang, Kazuyoshi Kohu, Mari Kaneko, Hiroshi Kiyonari, Atsushi Kaneda, Hideyuki Yoshida, Ichiro Taniuchi, Motomi Osato, Henry Yang, Michiaki Unno, Jimmy Bok-Yan So, Khay Guan Yeoh, Linda Shyue Huey Chuang, Suk-Chul Bae, Yoshiaki Ito.
Cellular and Molecular Gastroenterology and Hepatology 2022 Jan; 13(5):1317.
Application:WB-Ce, Human, HEK 293T cells.
-
Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma.
Lee YS, Lee JW, Jang JW, Chi XZ, Kim JH, Li YH, Kim MK, Kim DM, Choi BS, Kim EG, Chung JH, Lee OJ, Lee YM, Suh JW, Chuang LS, Ito Y, Bae SC.
Cancer Cell 2013 Nov; 24(5):603.
Application:IP-WB, WB-Tr, Human, HEK 293 cells.
-
The TGFβ→TAK1→LATS→YAP1 Pathway Regulates the Spatiotemporal Dynamics of YAP1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com