RAB4A monoclonal antibody (M01), clone 1C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RAB4A monoclonal antibody (M01), clone 1C10 Western Blot analysis of RAB4A expression in Hela ( Cat # L013V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RAB4A expression in transfected 293T cell line by RAB4A monoclonal antibody (M01), clone 1C10.
Lane 1: RAB4A transfected lysate(24.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB4A is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of RAB4A over-expressed 293 cell line, cotransfected with RAB4A Validated Chimera RNAi ( Cat # H00005867-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB4A monoclonal antibody (M01), clone 1C10 (Cat # H00005867-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (49.72 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RAB4A.
Immunogen
RAB4A (AAH04309, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.72 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB4A monoclonal antibody (M01), clone 1C10 Western Blot analysis of RAB4A expression in Hela ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RAB4A expression in transfected 293T cell line by RAB4A monoclonal antibody (M01), clone 1C10.
Lane 1: RAB4A transfected lysate(24.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB4A is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RAB4A over-expressed 293 cell line, cotransfected with RAB4A Validated Chimera RNAi ( Cat # H00005867-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB4A monoclonal antibody (M01), clone 1C10 (Cat # H00005867-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — RAB4A
Entrez GeneID
5867GeneBank Accession#
BC004309Protein Accession#
AAH04309Gene Name
RAB4A
Gene Alias
HRES-1/RAB4, RAB4
Gene Description
RAB4A, member RAS oncogene family
Omim ID
179511Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000035740|OTTHUMP00000042824|Oncogene RAB4|RAB4, member RAS oncogene family
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com