POU5F1 monoclonal antibody (M05), clone 1B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant POU5F1.
Immunogen
POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.24 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
POU5F1 monoclonal antibody (M05), clone 1B11 Western Blot analysis of POU5F1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of POU5F1 expression in transfected 293T cell line by POU5F1 monoclonal antibody (M05), clone 1B11.
Lane 1: POU5F1 transfected lysate(18.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
Immunofluorescence (Circulating Tumor Cell)
A-549 cells were stained with POU5F1-FITC labeled monoclonal antibody (Green). The cell nucleus were counterstained with DAPI (Blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to POU5F1 on A-549 cell. [antibody concentration 10 ug/ml]Immunofluorescence
Immunofluorescence of monoclonal antibody to POU5F1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — POU5F1
Entrez GeneID
5460GeneBank Accession#
BC020712Protein Accession#
AAH20712Gene Name
POU5F1
Gene Alias
MGC22487, OCT3, OCT4, OTF3, OTF4
Gene Description
POU class 5 homeobox 1
Omim ID
164177Gene Ontology
HyperlinkGene Summary
class 5
Other Designations
OTTHUMP00000029292|POU domain, class 5, transcription factor 1|POU-type homeodomain-containing DNA-binding protein|octamer-binding transcription factor-3
-
Interactome
-
Disease
-
Publication Reference
-
Physiologic Oxygen Concentration Enhances the Stem-Like Properties of CD133+ Human Glioblastoma Cells In vitro.
McCord AM, Jamal M, Shankavarum UT, Lang FF, Camphausen K, Tofilon PJ.
Molecular Cancer Research 2009 Apr; 7(4):489.
Application:WB-Ce, WB-Tr, Human, Human glioblastoma cells.
-
Physiologic Oxygen Concentration Enhances the Stem-Like Properties of CD133+ Human Glioblastoma Cells In vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com