PDGFRA (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PDGFRA partial ORF ( AAH15186, 105 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.28
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — PDGFRA
Entrez GeneID
5156GeneBank Accession#
BC015186Protein Accession#
AAH15186Gene Name
PDGFRA
Gene Alias
CD140A, MGC74795, PDGFR2, Rhe-PDGFRA
Gene Description
platelet-derived growth factor receptor, alpha polypeptide
Gene Ontology
HyperlinkGene Summary
This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies in knockout mice, where homozygosity is lethal, indicate that the alpha form of the platelet-derived growth factor receptor is particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes. [provided by RefSeq
Other Designations
FIP1L1/PDGFRA fusion protein|platelet-derived growth factor receptor alpha|rearranged-in-hypereosinophilia-platelet derived growth factor receptor alpha fusion protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com