PCMT1 monoclonal antibody (M02), clone 1D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PCMT1.
Immunogen
PCMT1 (NP_005380, 117 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PCMT1 monoclonal antibody (M02), clone 1D6. Western Blot analysis of PCMT1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
PCMT1 monoclonal antibody (M02), clone 1D6. Western Blot analysis of PCMT1 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
PCMT1 monoclonal antibody (M02), clone 1D6. Western Blot analysis of PCMT1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
PCMT1 monoclonal antibody (M02), clone 1D6 Western Blot analysis of PCMT1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PCMT1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — PCMT1
Entrez GeneID
5110GeneBank Accession#
NM_005389Protein Accession#
NP_005380Gene Name
PCMT1
Gene Alias
-
Gene Description
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Omim ID
176851Gene Ontology
HyperlinkGene Summary
Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.[supplied by OMIM
Other Designations
L-isoaspartyl/D-aspartyl methyltransferase|OTTHUMP00000017398|OTTHUMP00000017400
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com