OPA1 monoclonal antibody (M06), clone 8A32
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant OPA1.
Immunogen
OPA1 (NP_056375, 851 a.a. ~ 960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in human ovarian cancer.Western Blot (Tissue lysate)
OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in rat brain.Western Blot (Cell lysate)
OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in Daoy.Western Blot (Cell lysate)
OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of OPA1 expression in transfected 293T cell line by OPA1 monoclonal antibody (M06), clone 8A32.
Lane 1: OPA1 transfected lysate (Predicted MW: 111.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged OPA1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — OPA1
Entrez GeneID
4976GeneBank Accession#
NM_015560Protein Accession#
NP_056375Gene Name
OPA1
Gene Alias
FLJ12460, KIAA0567, MGM1, NPG, NTG, largeG
Gene Description
optic atrophy 1 (autosomal dominant)
Gene Ontology
HyperlinkGene Summary
This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000195065|mitochondrial dynamin-like GTPase|optic atrophy 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com