NODAL monoclonal antibody (M03), clone 5C3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NODAL.
Immunogen
NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.66 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NODAL monoclonal antibody (M03), clone 5C3. Western Blot analysis of NODAL expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
NODAL monoclonal antibody (M03), clone 5C3 Western Blot analysis of NODAL expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
NODAL monoclonal antibody (M03), clone 5C3. Western Blot analysis of NODAL expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NODAL on formalin-fixed paraffin-embedded human endometrium cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NODAL is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to NODAL on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NODAL
Entrez GeneID
4838GeneBank Accession#
NM_018055Protein Accession#
NP_060525Gene Name
NODAL
Gene Alias
MGC138230
Gene Description
nodal homolog (mouse)
Omim ID
601265Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development. [provided by RefSeq
Other Designations
OTTHUMP00000019754|nodal|nodal, mouse, homolog
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Reactivation of embryonic nodal signaling is associated with tumor progression and promotes the growth of prostate cancer cells.
Lawrence MG, Margaryan NV, Loessner D, Collins A, Kerr KM, Turner M, Seftor EA, Stephens CR, Lai J, Postovit LM, Clements JA, Hendrix MJ; APC BioResource.
The Prostate 2011 Aug; 71(11):1198.
Application:WB, Human, LNCaP, PC-3, 22Rv1, DU145, MDA-PCa-2b cells.
-
Reactivation of embryonic nodal signaling is associated with tumor progression and promotes the growth of prostate cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com