![](/upload/media/product/tag/abnova-maxpab-tag.png)
KITLG purified MaxPab rabbit polyclonal antibody (D01P)
![](/upload/media/country/usa2Egif.gif)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against a full-length human KITLG protein.
Immunogen
KITLG (NP_003985.2, 1 a.a. ~ 245 a.a) full-length human protein.
Sequence
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKGKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (72); Rat (72)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KITLG expression in transfected 293T cell line (H00004254-T01) by KITLG MaxPab polyclonal antibody.
Lane 1: KITLG transfected lysate(27.90 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between KITLG and FLT3LG. HeLa cells were stained with anti-KITLG rabbit purified polyclonal 1:1200 and anti-FLT3LG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — KITLG
Entrez GeneID
4254GeneBank Accession#
NM_003994Protein Accession#
NP_003985.2Gene Name
KITLG
Gene Alias
DKFZp686F2250, KL-1, Kitl, MGF, SCF, SF, SHEP7
Gene Description
KIT ligand
Omim ID
184745Gene Ontology
HyperlinkGene Summary
This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
mast cell growth factor|steel factor|stem cell factor
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com