NBR1 monoclonal antibody (M01), clone 6B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NBR1.
Immunogen
NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NBR1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — NBR1
Entrez GeneID
4077GeneBank Accession#
NM_005899Protein Accession#
NP_005890Gene Name
NBR1
Gene Alias
1A1-3B, KIAA0049, M17S2, MIG19
Gene Description
neighbor of BRCA1 gene 1
Omim ID
166945Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125)|migration-inducing protein 19
-
Interactome
-
Disease
-
Publication Reference
-
Sequestration of translation initiation factors in p62 condensates.
Alberto Danieli, Georg Vucak, Manuela Baccarini, Sascha Martens.
Cell Reports 2023 Dec; 42(12):113583.
Application:WB, Human, Hap1 cell, HeLa cells.
-
NAK-associated protein 1/NAP1 activates TBK1 to ensure accurate mitosis and cytokinesis.
Swagatika Paul, Shireen A Sarraf, Ki Hong Nam, Leila Zavar, Nicole DeFoor, Sahitya Ranjan Biswas, Lauren E Fritsch, Tomer M Yaron, Jared L Johnson, Emily M Huntsman, Lewis C Cantley, Alban Ordureau, Alicia M Pickrell.
The Journal of Cell Biology 2024 Feb; 223(2):e202303082.
Application:WB, Human, HeLa cells.
-
Removal of hypersignaling endosomes by simaphagy.
Simona M Migliano, Sebastian W Schultz, Eva M Wenzel, Szabolcs Takáts, Dan Liu, Silje Mørk, Kia Wee Tan, Tor Erik Rusten, Camilla Raiborg, Harald Stenmark.
Autophagy 2023 Oct; [Epub]:1.
Application:WB, Human, Human RPE cells.
-
Co-chaperone BAG3 enters autophagic pathway via its interaction with microtubule associated protein 1 light chain 3 beta.
Hagen Körschgen, Marius Baeken, Daniel Schmitt, Heike Nagel, Christian Behl.
Traffic (Copenhagen, Denmark) 2023 Sep; [Epub].
Application:PLA, Human, HeLa cells.
-
p62 and NBR1 functions are dispensable for aggrephagy in mouse ESCs and ESC-derived neurons.
Riccardo Trapannone, Julia Romanov, Sascha Martens.
Life Science Alliance 2023 Aug; 6(11):e202301936.
Application:WB, Mouse, Mouse embryonic stem cells, Mouse neuron.
-
Loss of the batten disease protein CLN3 leads to mis-trafficking of M6PR and defective autophagic-lysosomal reformation.
Alessia Calcagni', Leopoldo Staiano, Nicolina Zampelli, Nadia Minopoli, Niculin J Herz, Giuseppe Di Tullio, Tuong Huynh, Jlenia Monfregola, Alessandra Esposito, Carmine Cirillo, Aleksandar Bajic, Mahla Zahabiyon, Rachel Curnock, Elena Polishchuk, Luke Parkitny, Diego Luis Medina, Nunzia Pastore, Peter J Cullen, Giancarlo Parenti, Maria Antonietta De Matteis, Paolo Grumati, Andrea Ballabio.
Nature Communications 2023 Jul; 14(1):3911.
Application:WB, Human, N/A.
-
Reconstitution defines the roles of p62, NBR1 and TAX1BP1 in ubiquitin condensate formation and autophagy initiation.
Eleonora Turco, Adriana Savova, Flora Gere, Luca Ferrari, Julia Romanov, Martina Schuschnig, Sascha Martens.
Nature Communications 2021 Sep; 12(1):5212.
Application:WB, Human, HAP1, mSc-AID-NBR1 cells.
-
MOAP-1-mediated dissociation of p62/SQSTM1 bodies releases Keap1 and suppresses Nrf2 signaling.
Chong Teik Tan, Hao-Chun Chang, Qiling Zhou, Chundong Yu, Nai Yang Fu, Kanaga Sabapathy, Victor C Yu.
EMBO reports 2021 Jan; 22(1):e50854.
Application:WB-Tr, Human, HepG2 cells.
-
Loss of TAX1BP1-Directed Autophagy Results in Protein Aggregate Accumulation in the Brain.
Shireen A Sarraf, Hetal V Shah, Gil Kanfer, Alicia M Pickrell, Lynne A Holtzclaw, Michael E Ward, Richard J Youle.
Molecular Cell 2020 Dec; 80(5):779.
Application:WB-Ce, WB-Tr, Mouse, Rat, Mouse brain, Rat cortical neurons.
-
The Amyloid Inhibitor CLR01 Relieves Autophagy and Ameliorates Neuropathology in a Severe Lysosomal Storage Disease.
Monaco A, Maffia V, Sorrentino NC, Sambri I, Ezhova Y, Giuliano T, Cacace V, Nusco E, De Risi M, De Leonibus E, Schrader T, Klärner FG, Bitan G, Fraldi A.
Molecular Therapy 2020 Apr; 28(4):1167.
Application:WB-Ti, Mouse, Mouse brain.
-
Deubiquitinating enzyme USP30 maintains basal peroxisome abundance by regulating pexophagy.
Riccio V, Demers N, Hua R, Vissa M, Cheng DT, Strilchuk AW, Wang Y, McQuibban GA, Kim PK.
The Journal of Cell Biology 2019 Mar; 218(3):798.
Application:IF, Human, HeLa cells.
-
Autophagy Ablation in Adipocytes Induces Insulin Resistance and Reveals Roles for Lipid Peroxide and Nrf2 Signaling in Adipose-Liver Crosstalk.
Cai J, Pires KM, Ferhat M, Chaurasia B, Buffolo MA, Smalling R, Sargsyan A, Atkinson DL, Summers SA, Graham TE, Boudina S.
Cell Reports 2018 Nov; 25(7):1708.
Application:WB-Ti, Mouse, Epididymal white adipose, Brown adipose tissue.
-
Peroxin Pex14p is the key component for coordinated autophagic degradation of mammalian peroxisomes by direct binding to LC3-II.
Jiang L, Hara-Kuge S, Yamashita SI, Fujiki Y.
Genes to Cells 2015 Jan; 20(1):36.
Application:IF, IP-WB, WB-Tr, Mouse, CHO-K1 cells.
-
Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
Dowdle WE, Nyfeler B, Nagel J, Elling RA, Liu S, Triantafellow E, Menon S, Wang Z, Honda A, Pardee G, Cantwell J, Luu C, Cornella-Taracido I, Harrington E, Fekkes P, Lei H, Fang Q, Digan ME, Burdick D, Powers AF, Helliwell SB.
Nature Cell Biology 2014 Nov; 16(11):1069.
Application:WB-Ce, Human, H4 GFP-p62 cells.
-
Brain region- and age-dependent dysregulation of p62 and NBR1 in a mouse model of Huntington's disease.
Rue L, Lopez-Soop G, Gelpi E, Martinez-Vicente M, Alberch J, Perez-Navarro E.
Neurobiology of Disease 2013 Jan; 52:219.
Application:WB-Ti, Human, Mouse, Brain from Human patients with Huntington's disease (HD), Mouse brain.
-
NBR1 acts as an autophagy receptor for peroxisomes.
Deosaran E, Larsen KB, Hua R, Sargent G, Wang Y, Kim S, Lamark T, Jauregui M, Law K, Lippincott-Schwartz J, Brech A, Johansen T, Kim PK.
Journal of Cell Science 2013 Feb; 126(Pt 4):939.
Application:IF, WB-Tr, Human, HeLa cells.
-
Molecular determinants of selective clearance of protein inclusions by autophagy.
Wong E, Bejarano E, Rakshit M, Lee K, Hanson HH, Zaarur N, Phillips GR, Sherman MY, Cuervo AM.
Nature Communications 2012 Jun; 3:1240.
Application:WB-Ce, Human, Neuroblastoma cell line SY5Y.
-
Nbr1 is a novel inhibitor of ligand-mediated RTK degradation.
Mardakheh FK, Auciello G, Dafforn TR, Rappoport JZ, Heath JK.
Molecular and Cellular Biology 2010 Dec; 30(24):5672.
Application:WB-Tr, Human, HEK 293T, HeLa cells.
-
Spred2 interaction with the late endosomal protein NBR1 down-regulates fibroblast growth factor receptor signaling.
Mardakheh FK, Yekezare M, Machesky LM, Heath JK.
The Journal of Cell Biology 2009 Oct; 187(2):265.
Application:WB-Ce, Human, 293T, SH-SY5Y cell.
-
Sequestration of translation initiation factors in p62 condensates.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com