SH2D1A monoclonal antibody (M01), clone 1C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant SH2D1A.
Immunogen
SH2D1A (AAH20732, 1 a.a. ~ 128 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.82 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SH2D1A monoclonal antibody (M01), clone 1C9 Western Blot analysis of SH2D1A expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SH2D1A expression in transfected 293T cell line by SH2D1A monoclonal antibody (M01), clone 1C9.
Lane 1: SH2D1A transfected lysate(14.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SH2D1A is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SH2D1A
Entrez GeneID
4068GeneBank Accession#
BC020732Protein Accession#
AAH20732Gene Name
SH2D1A
Gene Alias
DSHP, EBVS, FLJ18687, FLJ92177, IMD5, LYP, MTCP1, SAP, XLP, XLPD
Gene Description
SH2 domain protein 1A
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Duncan's disease|OTTHUMP00000023976|SLAM-associated protein|T cell signal transduction molecule SAP|signaling lymphocyte activation molecule-associated protein
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Detailed Phenotypic and Functional Characterization of a Rare, Antibody-Dependent SLAM-Associated Protein Expression Pattern.
Khanolkar A, Wilks JD, Liu G, Caparelli EA, De Moura M, Yap KL, Mustafa A, Kadri S, Huang W, Zheng XT.
ImmunoHorizons 2020 Apr; 4(4):153.
Application:Flow Cyt, Human, Lymphocyte.
-
Transfer of gene corrected T cells corrects humoral and cytotoxic defects in X-linked lymphoproliferative disease (XLP1).
Panchal N, Houghton B, Diez B, Ghosh S, Ricciardelli I, Thrasher AJ, Gaspar HB, Booth C.
The Journal of Allergy and Clinical Immunology 2018 Apr; [Epub].
Application:Flow Cyt, SAP staining, Human, Mouse, PBMCs, splenic tissue.
-
Genetic predisposition to hemophagocytic lymphohistiocytosis: Report on 500 patients from the Italian registry.
Cetica V, Sieni E, Pende D, Danesino C, Fusco CD, Locatelli F, Micalizzi C, Putti MC, Biondi A, Fagioli F, Moretta L, Griffiths GM, Luzzatto L, Arico M.
The Journal of Allergy and Clinical Immunology 2016 Jan; 137(1):188.
Application:Flow Cyt, Human, Peripheral blood lymphocytes from patients with (Hemophagocytic lymphohistiocytosis) HLH.
-
Diagnosing XLP1 in patients with hemophagocytic lymphohistiocytosis.
Meazza R, Tuberosa C, Cetica V, Falco M, Parolini S, Grieve S, Griffiths GM, Sieni E, Marcenaro S, Micalizzi C, Montin D, Fagioli F, Moretta A, Mingari MC, Moretta L, Notarangelo LD, Bottino C, Arico M, Pende D.
The Journal of Allergy and Clinical Immunology 2014 Dec; 134(6):1381.
Application:Flow Cyt, WB-Tr, Human, NK, HEK-293T cells.
-
Signaling lymphocytic activation molecule (SLAM)/SLAM-associated protein pathway regulates human B-cell tolerance.
Menard L, Cantaert T, Chamberlain N, Tangye SG, Riminton S, Church JA, Klion A, Cunningham-Rundles C, Nichols KE, Meffre E.
The Journal of Allergy and Clinical Immunology 2014 Apr; 133(4):1149.
Application:Flow Cyt, Human, B cells.
-
Expansion of somatically reverted memory CD8+ T cells in patients with X-linked lymphoproliferative disease caused by selective pressure from Epstein-Barr virus.
Palendira U, Low C, Bell AI, Ma CS, Abbott RJ, Phan TG, Riminton DS, Choo S, Smart JM, Lougaris V, Giliani S, Buckley RH, Grimbacher B, Alvaro F, Klion AD, Nichols KE, Adelstein S, Rickinson AB, Tangye SG.
The Journal of Experimental Medicine 2012 May; 209(5):913.
Application:Flow Cyt , Human, PBMCs.
-
Molecular Pathogenesis of EBV Susceptibility in XLP as Revealed by Analysis of Female Carriers with Heterozygous Expression of SAP.
Palendira U, Low C, Chan A, Hislop AD, Ho E, Phan TG, Deenick E, Cook MC, Riminton DS, Choo S, Loh R, Alvaro F, Booth C, Gaspar HB, Moretta A, Khanna R, Rickinson AB, Tangye SG.
PLoS Biology 2011 Nov; 9(11):e1001187.
Application:Flow Cyt, Human, PBMCs.
-
Early commitment of naive human CD4(+) T cells to the T follicular helper (T(FH)) cell lineage is induced by IL-12.
Ma CS, Suryani S, Avery DT, Chan A, Nanan R, Santner-Nanan B, Deenick EK, Tangye SG.
Immunology and Cell Biology 2009 Nov; 87(8):590.
Application:Func, Human, T cells.
-
Detailed Phenotypic and Functional Characterization of a Rare, Antibody-Dependent SLAM-Associated Protein Expression Pattern.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com