HOXC12 monoclonal antibody (M07), clone 2A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HOXC12.
Immunogen
HOXC12 (NP_776272, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCA
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
HOXC12 monoclonal antibody (M07), clone 2A4 Western Blot analysis of HOXC12 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HOXC12 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — HOXC12
Entrez GeneID
3228GeneBank Accession#
NM_173860Protein Accession#
NP_776272Gene Name
HOXC12
Gene Alias
HOC3F, HOX3, HOX3F
Gene Description
homeobox C12
Omim ID
142975Gene Ontology
HyperlinkGene Summary
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq
Other Designations
homeo box 3F|homeo box C12
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com