GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00002939-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

GSTA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA2 expression in human liver.

Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

GSTA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA2 expression in mouse liver.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of GSTA2 expression in transfected 293T cell line (H00002939-T02) by GSTA2 MaxPab polyclonal antibody.

Lane 1: GSTA2 transfected lysate(25.70 KDa).
Lane 2: Non-transfected lysate.

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human GSTA2 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    GSTA2 (NP_000837.2, 1 a.a. ~ 222 a.a) full-length human protein.

    Sequence

    MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

    Host

    Rabbit

    Reactivity

    Human, Mouse

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    GSTA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA2 expression in human liver.

    Western Blot (Tissue lysate)

    GSTA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA2 expression in mouse liver.

    Western Blot (Transfected lysate)

    Western Blot analysis of GSTA2 expression in transfected 293T cell line (H00002939-T02) by GSTA2 MaxPab polyclonal antibody.

    Lane 1: GSTA2 transfected lysate(25.70 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — GSTA2

    Entrez GeneID

    2939

    GeneBank Accession#

    NM_000846.3

    Protein Accession#

    NP_000837.2

    Gene Name

    GSTA2

    Gene Alias

    GST2, GSTA2-2, GTA2, GTH2, MGC10525

    Gene Description

    glutathione S-transferase alpha 2

    Omim ID

    138360

    Gene Ontology

    Hyperlink

    Gene Summary

    Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq

    Other Designations

    GST, class alpha, 2|GST-gamma|HA subunit 2|OTTHUMP00000017883|S-(hydroxyalkyl)glutathione lyase A2|glutathione S-alkyltransferase A2|glutathione S-aralkyltransferase A2|glutathione S-aryltransferase A2|glutathione S-transferase 2|glutathione S-transferase

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All