GSTA2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GSTA2 protein.
Immunogen
GSTA2 (NP_000837.2, 1 a.a. ~ 222 a.a) full-length human protein.
Sequence
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GSTA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA2 expression in human liver.Western Blot (Tissue lysate)
GSTA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTA2 expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of GSTA2 expression in transfected 293T cell line (H00002939-T02) by GSTA2 MaxPab polyclonal antibody.
Lane 1: GSTA2 transfected lysate(25.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GSTA2
Entrez GeneID
2939GeneBank Accession#
NM_000846.3Protein Accession#
NP_000837.2Gene Name
GSTA2
Gene Alias
GST2, GSTA2-2, GTA2, GTH2, MGC10525
Gene Description
glutathione S-transferase alpha 2
Omim ID
138360Gene Ontology
HyperlinkGene Summary
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation. [provided by RefSeq
Other Designations
GST, class alpha, 2|GST-gamma|HA subunit 2|OTTHUMP00000017883|S-(hydroxyalkyl)glutathione lyase A2|glutathione S-alkyltransferase A2|glutathione S-aralkyltransferase A2|glutathione S-aryltransferase A2|glutathione S-transferase 2|glutathione S-transferase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com