GPR24 monoclonal antibody (M01), clone 3D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GPR24 monoclonal antibody (M01), clone 3D7 Western Blot analysis of GPR24 expression in HL-60 ( Cat # L014V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GPR24 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GPR24.
Immunogen
GPR24 (AAH01736, 14 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GPR24 monoclonal antibody (M01), clone 3D7 Western Blot analysis of GPR24 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GPR24 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — MCHR1
Entrez GeneID
2847GeneBank Accession#
BC001736Protein Accession#
AAH01736Gene Name
MCHR1
Gene Alias
GPR24, MCH1R, MGC32129, SLC1
Gene Description
melanin-concentrating hormone receptor 1
Omim ID
601751Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq
Other Designations
G protein-coupled receptor 24|G-protein coupled receptor 24
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com