GCH1 monoclonal antibody (M01), clone 4A12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GCH1 monoclonal antibody (M01), clone 4A12 Western Blot analysis of GCH1 expression in MCF-7.
Western Blot (Transfected lysate)
Western Blot analysis of GCH1 expression in transfected 293T cell line by GCH1 monoclonal antibody (M01), clone 4A12.
Lane 1: GCH1 transfected lysate(27.9 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GCH1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of GCH1 transfected lysate using anti-GCH1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GCH1 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GCH1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant GCH1.
Immunogen
GCH1 (NP_000152, 84 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GCH1 monoclonal antibody (M01), clone 4A12 Western Blot analysis of GCH1 expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of GCH1 expression in transfected 293T cell line by GCH1 monoclonal antibody (M01), clone 4A12.
Lane 1: GCH1 transfected lysate(27.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GCH1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of GCH1 transfected lysate using anti-GCH1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GCH1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GCH1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — GCH1
Entrez GeneID
2643GeneBank Accession#
NM_000161Protein Accession#
NP_000152Gene Name
GCH1
Gene Alias
DYT14, DYT5, GCH, GTP-CH-1, GTPCH1
Gene Description
GTP cyclohydrolase 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme. [provided by RefSeq
Other Designations
guanosine 5'-triphosphate cyclohydrolase I
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Cross-species RNAi therapy via AAV delivery alleviates neuropathic pain by targeting GCH1.
Heesue Chang, Kyoung Jin Lee, Minkyung Park, Ha-Na Woo, Ji Hyun Kim, Im Kyeung Kang, Hyochan Park, Chan Hee Chon, Heuiran Lee, Hyun Ho Jung.
Neurotherapeutics : the Journal of the American Society for Experimental NeuroTherapeutics. 2024 Dec; 0:e00511.
Application：WB, IHC, Human, Rat, Dorsal root ganglion, HeLa cells.
-
DJ-1 is an essential downstream mediator in PINK1/parkin-dependent mitophagy.
Dorien Imberechts, Inge Kinnart, Fieke Wauters, Joanne Terbeek, Liselot Manders, Keimpe Wierda, Kristel Eggermont, Rodrigo Furtado Madeiro, Carolyn Sue, Catherine Verfaillie, Wim Vandenberghe.
Brain 2022 Dec; 145(12):4368.
Application：PLA, Human, Human fibroblasts.
-
Metabolic determinants of cancer cell sensitivity to canonical ferroptosis inducers.
Mariluz Soula, Ross A Weber, Omkar Zilka, Hanan Alwaseem, Konnor La, Frederick Yen, Henrik Molina, Javier Garcia-Bermudez, Derek A Pratt, Kıvanç Birsoy.
Nature Chemical Biology 2020 Dec; 16(12):1351.
Application：WB-Tr, Human, Jurkat cells.
-
T Cell-Derived IL-17A Induces Vascular Dysfunction via Perivascular Fibrosis Formation and Dysregulation of ·NO/cGMP Signaling.
Schüler R, Efentakis P, Wild J, Lagrange J, Garlapati V, Molitor M, Kossmann S, Oelze M, Stamm P, Li H, Schäfer K, Münzel T, Daiber A, Waisman A, Wenzel P, Karbach SH.
Oxidative Medicine and Cellular Longevity 2019 Jul; 2019:6721531.
Application：WB, Mouse, Aortic, PVAT.
-
Mast cell tetrahydrobiopterin contributes to itch in mice.
Zschiebsch K, Fischer C, Wilken-Schmitz A, Geisslinger G, Channon K, Watschinger K, Tegeder I.
Journal of Cellular and Molecular Medicine 2019 Feb; 23(2):985.
Application：IF, Mouse, Macrophages, Mast cells.
-
Metformin attenuates fluctuating glucose-induced endothelial dysfunction through enhancing GTPCH1-mediated eNOS recoupling and inhibiting NADPH oxidase.
An H, Wei R, Ke J, Yang J, Liu Y, Wang X, Wang G, Hong T.
Journal of Diabetes and Its Complications 2016 Apr; 30(6):1017.
Application：WB-Ce, Human, HUVEC.
-
Effect of soluble guanylyl cyclase activator and stimulator therapy on nitroglycerin-induced nitrate tolerance in rats.
Jabs A, Oelze M, Mikhed Y, Stamm P, Kröller-Schön S, Welschof P, Jansen T, Hausding M, Kopp M, Steven S, Schulz E, Stasch JP, Münzel T, Daiber A.
Vascular Pharmacology 2015 Aug; 71:181.
Application：WB-Ti, Rat, Aortic.
-
Inflammatory Monocytes Determine Endothelial Nitric Oxide Synthase Uncoupling and Nitro-oxidative Stress Induced by Angiotensin II.
Kossmann S, Hu H, Steven S, Schonfelder T, Fraccarollo D, Mikhed Y, Brahler M, Knorr M, Brandt M, Karbach SH, Becker C, Oelze M, Bauersachs J, Widder J, Munzel T, Daiber A, Wenzel P.
The Journal of Biological Chemistry 2014 Oct; 289(40):27540.
Application：WB, Mouse, Aortic tissue.
-
Redox activation of DUSP4 by N-acetylcysteine protects endothelial cells from Cd2+-induced apoptosis.
Barajas-Espinosa A, Basye A, Jesse E, Yan H, Quan D, Chen CA.
Free Radical Biology & Medicine 2014 Sep; 74:188.
Application：WB-Ce, Bovine, Bovine aortic endothelia lcells.
-
Inhibition of GTP cyclohydrolase attenuates tumor growth by reducing angiogenesis and M2-like polarization of tumor associated macrophages.
Pickert G, Lim HY, Weigert A, Häussler A, Myrczek T, Waldner M, Labocha S, Ferreirós N, Geisslinger G, Lötsch J, Becker C, Brüne B, Tegeder I.
International Journal of Cancer 2013 Feb; 132(3):591.
Application：IF, WB-Ce, WB-Tr, WB-Ti, Human, Mouse, HUVECs, HT29 cells, Colon, Skin cancer.
-
Differential effects of heart rate reduction with ivabradine in two models of endothelial dysfunction and oxidative stress.
Kroller-Schon S, Schulz E, Wenzel P, Kleschyov AL, Hortmann M, Torzewski M, Oelze M, Renne T, Daiber A, Munzel T.
Basic Research in Cardiology 2011 Nov; 106(6):1147.
Application：WB-Ti, Mouse, Mouse aortic homogenates.
-
Vascular dysfunction in experimental diabetes is improved by pentaerithrityl tetranitrate but not isosorbide-5-mononitrate therapy.
Schuhmacher S, Oelze M, Bollmann F, Kleinert H, Otto C, Heeren T, Steven S, Hausding M, Knorr M, Pautz A, Reifenberg K, Schulz E, Gori T, Wenzel P, Munzel T, Daiber A.
Diabetes 2011 Oct; 60(10):2608.
Application：WB-Ti, Rat, Rat aorta.
-
Sepiapterin improves angiogenesis of pulmonary artery endothelial cells with in utero pulmonary hypertension by recoupling endothelial nitric oxide synthase.
Teng RJ, Du J, Xu H, Bakhutashvili I, Eis A, Shi Y, Pritchard KA Jr, Konduri GG.
Am J Physiol Lung Cell Mol Physiol 2011 May; 301:334.
Application：WB-Ce, Bovine, Pulmonary artery endothelial cells.
-
Vascular Dysfunction in Streptozotocin-Induced Experimental Diabetes Strictly Depends on Insulin Deficiency.
Oelze M, Knorr M, Schuhmacher S, Heeren T, Otto C, Schulz E, Reifenberg K, Wenzel P, Munzel T, Daiber A.
Journal of Vascular Research 2011 Jan; 48(4):275.
Application：WB, Rat, Aortic tissue.
-
Role of angiotensin II on dihydrofolate reductase, GTP-cyclohydrolase 1 and nitric oxide synthase expressions in renal ischemia-reperfusion.
Seujange Y, Eiam-Ong S, Tirawatnapong T, Eiam-Ong S.
American Journal of Nephrology 2008 Apr; 28(4):692.
Application：WB-Ti, Rat, Rat kidney.
-
Mechanisms underlying recoupling of eNOS by HMG-CoA reductase inhibition in a rat model of streptozotocin-induced diabetes mellitus.
Wenzel P, Daiber A, Oelze M, Brandt M, Closs E, Xu J, Thum T, Bauersachs J, Ertl G, Zou MH, Forstermann U, Munzel T.
Atherosclerosis 2007 Dec; 198(1):65.
Application：WB, Rat, Rat aortic tissues.
-
Regulation of Tetrahydrobiopterin Biosynthesis by Shear Stress.
Widder JD, Chen W, Li L, Dikalov S, Thony B, Hatakeyama K, Harrison DG.
Circulation Research 2007 Aug; 101(8):830.
Application：IP-WB, Human, Human aortic endothelial cells (HAECs).
-
Cross-species RNAi therapy via AAV delivery alleviates neuropathic pain by targeting GCH1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com