FGB monoclonal antibody (M01), clone 1D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FGB.
Immunogen
FGB (NP_005132, 392 a.a. ~ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FGB monoclonal antibody (M01), clone 1D7. Western Blot analysis of FGB expression in HepG2.Western Blot (Cell lysate)
FGB monoclonal antibody (M01), clone 1D7. Western Blot analysis of FGB expression in PC-12.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGB is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — FGB
Entrez GeneID
2244GeneBank Accession#
NM_005141Protein Accession#
NP_005132Gene Name
FGB
Gene Alias
MGC104327, MGC120405
Gene Description
fibrinogen beta chain
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. [provided by RefSeq
Other Designations
fibrinogen, B beta polypeptide|fibrinogen, beta chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com