EVX1 monoclonal antibody (M07), clone 1B7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant EVX1.
Immunogen
EVX1 (NP_001980, 2 a.a. ~ 110 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQP*
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (89)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EVX1 monoclonal antibody (M07), clone 1B7 Western Blot analysis of EVX1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
EVX1 monoclonal antibody (M07), clone 1B7. Western Blot analysis of EVX1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
EVX1 monoclonal antibody (M07), clone 1B7. Western Blot analysis of EVX1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
EVX1 monoclonal antibody (M07), clone 1B7. Western Blot analysis of EVX1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — EVX1
Entrez GeneID
2128GeneBank Accession#
NM_001989Protein Accession#
NP_001980Gene Name
EVX1
Gene Alias
-
Gene Description
even-skipped homeobox 1
Omim ID
142996Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. [provided by RefSeq
Other Designations
eve, even-skipped homeo box homolog 1|eve, even-skipped homeobox homolog 1|even-skipped homeo box 1 (homolog of Drosophila)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com