EPOR monoclonal antibody (M01), clone 3D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EPOR monoclonal antibody (M01), clone 3D10. Western Blot analysis of EPOR expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of EPOR expression in transfected 293T cell line by EPOR monoclonal antibody (M01), clone 3D10.
Lane 1: EPOR transfected lysate (Predicted MW: 55.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of EPOR transfected lysate using anti-EPOR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EPOR MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPOR is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPOR.
Immunogen
EPOR (NP_000112, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EPOR monoclonal antibody (M01), clone 3D10. Western Blot analysis of EPOR expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of EPOR expression in transfected 293T cell line by EPOR monoclonal antibody (M01), clone 3D10.
Lane 1: EPOR transfected lysate (Predicted MW: 55.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of EPOR transfected lysate using anti-EPOR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EPOR MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPOR is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — EPOR
Entrez GeneID
2057GeneBank Accession#
NM_000121Protein Accession#
NP_000112Gene Name
EPOR
Gene Alias
MGC138358
Gene Description
erythropoietin receptor
Gene Ontology
HyperlinkGene Summary
The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. [provided by RefSeq
Other Designations
-
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
GATA2 regulates the erythropoietin receptor in t(12;21) ALL.
Gaine ME, Sharpe DJ, Smith JS, Colyer HAA, Hodges VM, Lappin TR, Mills KI.
Oncotarget 2017 Aug; 8(39):66061.
Application：WB, Human, NALM-6, REH, UT-7 cells.
-
GATA2 regulates the erythropoietin receptor in t(12;21) ALL.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com