EEF1G purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human EEF1G protein.
Immunogen
EEF1G (NP_001395.1, 1 a.a. ~ 437 a.a) full-length human protein.
Sequence
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK
Host
Rabbit
Reactivity
Human, Mouse, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
EEF1G MaxPab rabbit polyclonal antibody. Western Blot analysis of EEF1G expression in mouse testis.Western Blot (Tissue lysate)
EEF1G MaxPab rabbit polyclonal antibody. Western Blot analysis of EEF1G expression in human placenta.Western Blot (Cell lysate)
EEF1G MaxPab rabbit polyclonal antibody. Western Blot analysis of EEF1G expression in IMR-32.Western Blot (Cell lysate)
EEF1G MaxPab rabbit polyclonal antibody. Western Blot analysis of EEF1G expression in PC-12.Western Blot (Cell lysate)
EEF1G MaxPab rabbit polyclonal antibody. Western Blot analysis of EEF1G expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of EEF1G expression in transfected 293T cell line (H00001937-T02) by EEF1G MaxPab polyclonal antibody.
Lane 1: EEF1G transfected lysate(50.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EEF1G
Entrez GeneID
1937GeneBank Accession#
NM_001404Protein Accession#
NP_001395.1Gene Name
EEF1G
Gene Alias
EF1G, GIG35
Gene Description
eukaryotic translation elongation factor 1 gamma
Omim ID
130593Gene Ontology
HyperlinkGene Summary
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases. [provided by RefSeq
Other Designations
EF-1-gamma|PRO1608|eEF-1B gamma|elongation factor 1-gamma|pancreatic tumor-related protein|translation elongation factor eEF-1 gamma chain
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com