CSH2 mouse monoclonal antibody (hybridoma)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CSH2.
Immunogen
CSH2 (NP_066271.1, 1 a.a. ~ 217 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactivity and specificity confirmed by ELISA and Western Blot.
Deliverables
Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
Note
Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
-
Applications
Western Blot (Transfected lysate)
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CSH2
Entrez GeneID
1443GeneBank Accession#
NM_020991.3Protein Accession#
NP_066271.1Gene Name
CSH2
Gene Alias
CS-2, CSB, hCS-B
Gene Description
chorionic somatomammotropin hormone 2
Omim ID
118820Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity. [provided by RefSeq
Other Designations
chorionic somatomammotropin B|placental lactogen
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com