CRKL monoclonal antibody (M03), clone 4B5

Catalog # H00001399-M03

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody (M03), clone 4B5.

Lane 1: CRKL transfected lysate(33.8 KDa).
Lane 2: Non-transfected lysate.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged CRKL is approximately 0.3ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi ( Cat # H00001399-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody (M03), clone 4B5 (Cat # H00001399-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with anti-GAB1 rabbit purified polyclonal 1:1200 and anti-CRKL mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with anti-PTK2 rabbit purified polyclonal 1:600 and anti-CRKL mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between HCK and CRKL. Mahlavu cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-CRKL mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Immunofluorescence
Application

Immunofluorescence

Immunofluorescence of monoclonal antibody to CRKL on HeLa cell . [antibody concentration 10 ug/ml]

QC Test

Western Blot detection against Immunogen (36.74 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant CRKL.

    Immunogen

    CRKL (NP_005198, 204 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE

    Host

    Mouse

    Reactivity

    Human

    Isotype

    IgG2b Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.74 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of CRKL expression in transfected 293T cell line by CRKL monoclonal antibody (M03), clone 4B5.

    Lane 1: CRKL transfected lysate(33.8 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged CRKL is approximately 0.3ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of CRKL over-expressed 293 cell line, cotransfected with CRKL Validated Chimera RNAi ( Cat # H00001399-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CRKL monoclonal antibody (M03), clone 4B5 (Cat # H00001399-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between GAB1 and CRKL. HeLa cells were stained with anti-GAB1 rabbit purified polyclonal 1:1200 and anti-CRKL mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between PTK2 and CRKL. Huh7 cells were stained with anti-PTK2 rabbit purified polyclonal 1:600 and anti-CRKL mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between HCK and CRKL. Mahlavu cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-CRKL mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

    Immunofluorescence

    Immunofluorescence of monoclonal antibody to CRKL on HeLa cell . [antibody concentration 10 ug/ml]
  • Gene Info — CRKL

    Entrez GeneID

    1399

    GeneBank Accession#

    NM_005207

    Protein Accession#

    NP_005198

    Gene Name

    CRKL

    Gene Alias

    -

    Gene Description

    v-crk sarcoma virus CT10 oncogene homolog (avian)-like

    Omim ID

    602007

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic

    Other Designations

    v-crk avian sarcoma virus CT10 oncogene homolog-like

  • Interactome
  • Pathway
  • Disease
  • Publication Reference
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All