CREM monoclonal antibody (M02), clone 3B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CREM.
Immunogen
CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CREM monoclonal antibody (M02), clone 3B5. Western Blot analysis of CREM expression in human liver.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CREM is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CREM on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CREM
Entrez GeneID
1390GeneBank Accession#
NM_181571Protein Accession#
NP_853549Gene Name
CREM
Gene Alias
ICER, MGC111110, MGC17881, MGC41893, hCREM-2
Gene Description
cAMP responsive element modulator
Omim ID
123812Gene Ontology
HyperlinkGene Summary
This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq
Other Designations
OTTHUMP00000019442|OTTHUMP00000019443|OTTHUMP00000019444|OTTHUMP00000019446|OTTHUMP00000019448|cAMP response element modulator|hCREM 2alpha-b protein|hCREM 2beta-a protein|inducible cAMP early repressor ICER
-
Interactome
-
Disease
-
Publication Reference
-
Dual regulation of miR-375 and CREM genes in pancreatic beta cells.
David M Keller, Isis G Perez.
Islets 2022 Dec; 14(1):139.
Application:CHIP, IP, WB, Human, Rat, HEK 293T, Beta, INS-1 cells.
-
Dual regulation of miR-375 and CREM genes in pancreatic beta cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com