TPP1 monoclonal antibody (M01J), clone 3B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TPP1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
TPP1 (AAH14863.1, 195 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TPP1 monoclonal antibody (M01J), clone 3B1. Western Blot analysis of TPP1 expression in A-431.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TPP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TPP1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — TPP1
Entrez GeneID
1200GeneBank Accession#
BC014863.1Protein Accession#
AAH14863.1Gene Name
TPP1
Gene Alias
CLN2, GIG1, LPIC, MGC21297
Gene Description
tripeptidyl peptidase I
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. [provided by RefSeq
Other Designations
ceroid-lipofuscinosis, neuronal 2, late infantile (Jansky-Bielschowsky disease)|growth-inhibiting protein 1|lysosomal pepstatin insensitive protease|tripeptidyl aminopeptidase|tripeptidyl-peptidase I
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com