CDKN2D (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CDKN2D full-length ORF ( AAH01822, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
44
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CDKN2D
Entrez GeneID
1032GeneBank Accession#
BC001822Protein Accession#
AAH01822Gene Name
CDKN2D
Gene Alias
INK4D, p19, p19-INK4D
Gene Description
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Omim ID
600927Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq
Other Designations
CDK inhibitor p19INK4d|cell cycle inhibitor, Nur77 associating protein|cyclin-dependent kinase 4 inhibitor D p19|cyclin-dependent kinase inhibitor 2D|inhibitor of cyclin-dependent kinase 4d
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com