CDKN1B monoclonal antibody (M01), clone 4B4-E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CDKN1B.
Immunogen
CDKN1B (AAH01971, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATGDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDKN1B expression in transfected 293T cell line by CDKN1B monoclonal antibody (M01), clone 4B4-E6.
Lane 1: CDKN1B transfected lysate(22.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CDKN1B on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDKN1B is 0.03 ng/ml as a capture antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDKN1B is 10 ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between AKT1 and CDKN1B. HeLa cells were stained with anti-AKT1 rabbit purified polyclonal 1:1200 and anti-CDKN1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to CDKN1B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CDKN1B
Entrez GeneID
1027GeneBank Accession#
BC001971Protein Accession#
AAH01971Gene Name
CDKN1B
Gene Alias
CDKN4, KIP1, MEN1B, MEN4, P27KIP1
Gene Description
cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Gene Ontology
HyperlinkGene Summary
This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. [provided by RefSeq
Other Designations
cyclin-dependent kinase inhibitor 1B
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Increase of Intracellular Cyclic Amp by PDE4 Inhibitors Affects HepG2 Cell Cycle Progression and Survival.
Massimi M, Cardarelli S, Galli F, Giardi MF, Ragusa F, Panera N, Cinque B, Cifone MG, Biagioni S, Giorgi M.
Journal of Cellular Biochemistry 2017 Jun; 118(6):1401.
Application:WB, Human, HepG2 cells.
-
Increase of Intracellular Cyclic Amp by PDE4 Inhibitors Affects HepG2 Cell Cycle Progression and Survival.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com