

CD63 DNAxPab

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Rabbit polyclonal antibody raised against a partial-length human CD63 DNA using DNAx™ Immune technology.
Technology
Immunogen
CD63 (NP_001771.1, 33 a.a. ~ 203 a.a) partial-length human DNA
Sequence
VGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
Host
Rabbit
Reactivity
Human
Purification
Protein A
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CD63 expression in transfected 293T cell line by CD63 DNAxPab polyclonal antibody.
Lane 1: CD63 transfected lysate(39.93 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence (Transfected cell)
Flow Cytometry (Transfected cell)
-
Gene Info — CD63
Entrez GeneID
967GeneBank Accession#
NM_001780.4Protein Accession#
NP_001771.1Gene Name
CD63
Gene Alias
LAMP-3, ME491, MLA1, OMA81H, TSPAN30
Gene Description
CD63 molecule
Omim ID
155740Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. The use of alternate polyadenylation sites has been found for this gene. Alternative splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq
Other Designations
CD63 antigen|CD63 antigen (melanoma 1 antigen)|granulophysin|lysosome-associated membrane glycoprotein 3|melanoma 1 antigen|melanoma-associated antigen ME491|melanoma-associated antigen MLA1|ocular melanoma-associated antigen|tetraspanin-30
-
Interactomes
-
Pathways
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com