CD53 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CD53 full-length ORF (NP_000551.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).Sequence
MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
24.3
Interspecies Antigen Sequence
Mouse (83); Rat (81)
Form
Liquid
Preparation Method
in vitro wheat germ expression system with proprietary liposome technology
Purification
None
Recommend Usage
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Antibody Production
-
Gene Info — CD53
Entrez GeneID
963GeneBank Accession#
NM_000560.3Protein Accession#
NP_000551.1Gene Name
CD53
Gene Alias
MOX44, TSPAN25
Gene Description
CD53 molecule
Omim ID
151525Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
Other Designations
CD53 antigen|CD53 glycoprotein|CD53 tetraspan antigen|OTTHUMP00000013686|OTTHUMP00000059505|antigen MOX44 identified by monoclonal antibody MRC-OX44|cell surface antigen|leukocyte surface antigen CD53|tetraspanin-25|transmembrane glycoprotein
-
Interactome
-
Disease
-
Publication Reference
-
The tetraspanin web revisited by super-resolution microscopy.
Zuidscherwoude M, Gottfert F, Dunlock VM, Figdor CG, van den Bogaart G, Spriel AB.
Scientific Reports 2015 Jul; 5:12201.
Application：WB, Human, JY cells.
-
The tetraspanin web revisited by super-resolution microscopy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com