CD40 monoclonal antibody (K06), clone 3F1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CD40 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 6 ug/ml]
Western Blot detection against Immunogen (22.11 kDa).
-
Specification
Product Description
Rabbit monoclonal antibody raised against a partial recombinant CD40.
Immunogen
Purified CD40 (AAH12419.1 , 21 a.a. - 193 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Sequence
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Host
Rabbit
Reactivity
Human
Preparation Method
Cell Culture Production
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (22.11 kDa).
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CD40 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 6 ug/ml]ELISA
-
Gene Info — CD40
Entrez GeneID
958GeneBank Accession#
BC012419.1Protein Accession#
AAH12419.1Gene Name
CD40
Gene Alias
Bp50, CDW40, MGC9013, TNFRSF5, p50
Gene Description
CD40 molecule, TNF receptor superfamily member 5
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
B cell surface antigen CD40|B cell-associated molecule|CD40 antigen|CD40 antigen (TNF receptor superfamily member 5)|CD40 type II isoform|CD40L receptor|OTTHUMP00000031699|OTTHUMP00000031700|nerve growth factor receptor-related B-lymphocyte activation mol
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com