CD5L monoclonal antibody (M01), clone 1C8

* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant CD5L.
Immunogen
CD5L (AAH33586, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QKGQWGTVCDDGWDIKDVAVLCRELGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (67); Rat (62)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CD5L monoclonal antibody (M01), clone 1C8. Western Blot analysis of CD5L expression in HL-60 ( Cat # L014V1 ).Western Blot (Cell lysate)
CD5L monoclonal antibody (M01), clone 1C8. Western Blot analysis of CD5L expression in different cell lines.Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of CD5L transfected lysate using anti-CD5L monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CD5L MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CD5L is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CD5L
Entrez GeneID
922GeneBank Accession#
BC033586Protein Accession#
AAH33586Gene Name
CD5L
Gene Alias
AIM, API6, PRO229, SP-ALPHA, Spalpha
Gene Description
CD5 molecule-like
Omim ID
602592Gene Ontology
HyperlinkOther Designations
CD5 antigen-like (scavenger receptor cysteine rich family)|OTTHUMP00000024057|OTTHUMP00000060075|apoptosis inhibitor 6
-
Diseases
-
Publication Reference
-
CD5L Promotes M2 Macrophage Polarization through Autophagy-Mediated Upregulation of ID3.
Sanjurjo L, Aran G, Téllez É, Amézaga N, Armengol C, López D, Prats C, Sarrias MR.
Frontiers in Immunology 2018 Mar; 9:480.
Application:IF, Human, Peripheral blood monocytes.
-
CD5L is upregulated in hepatocellular carcinoma and promotes liver cancer cell proliferation and antiapoptotic responses by binding to HSPA5 (GRP78).
Aran G, Sanjurjo L, Bárcena C, Simon-Coma M, Téllez É, Vázquez-Vitali M, Garrido M, Guerra L, Díaz E, Ojanguren I, Elortza F, Planas R, Sala M, Armengol C, Sarrias MR.
FASEB Journal 2018 Feb; fj20170094.
Application:IF, IHC, IP, WB-Ce, Human, Liver cancers, Huh7, HepG2, SNU398 cells.
-
CD5L Promotes M2 Macrophage Polarization through Autophagy-Mediated Upregulation of ID3.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com