RUNX3 (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RUNX3 full-length ORF (1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYRGPRRTRAGPSRPTRPPTTSTTGHPLAPTSSPWWPAAAVGATAHLPACWPLAPAALPLSPPATS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.7
Interspecies Antigen Sequence
Rat (80)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RUNX3
Entrez GeneID
864GeneBank Accession#
AK091829.1Gene Name
RUNX3
Gene Alias
AML2, CBFA3, FLJ34510, MGC16070, PEBP2aC
Gene Description
runt-related transcription factor 3
Omim ID
600210Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the runt domain-containing family of transcription factors. A heterodimer of this protein and a beta subunit forms a complex that binds to the core DNA sequence 5'-PYGPYGGT-3' found in a number of enhancers and promoters, and can either activate or suppress transcription. It also interacts with other transcription factors. It functions as a tumor suppressor, and the gene is frequently deleted or transcriptionally silenced in cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000003370|OTTHUMP00000003371|PEA2 alpha C|PEBP2 alpha C|acute myeloid leukemia gene 2|core-binding factor, runt domain, alpha subunit 3|polyomavirus enhancer-binding protein 2 alpha C subunit|transcription factor AML2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com