CAPS monoclonal antibody (M01), clone 4C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CAPS.
Immunogen
CAPS (NP_004049, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSG
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CAPS expression in transfected 293T cell line by CAPS monoclonal antibody (M01), clone 4C6.
Lane 1: CAPS transfected lysate(21 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CAPS is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CAPS over-expressed 293 cell line, cotransfected with CAPS Validated Chimera RNAi ( Cat # H00000828-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPS monoclonal antibody (M01), clone 4C6 (Cat # H00000828-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CAPS
Entrez GeneID
828GeneBank Accession#
NM_004058Protein Accession#
NP_004049Gene Name
CAPS
Gene Alias
CAPS1, MGC126562
Gene Description
calcyphosine
Omim ID
114212Gene Ontology
HyperlinkGene Summary
This gene encodes a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit. Alternative splicing of this gene generates two transcript variants. [provided by RefSeq
Other Designations
calcyphosine 1|thyroid protein p24
-
Interactome
-
Disease
-
Publication Reference
-
Identification of Novel Biomarkers in Pediatric Primitive Neuroectodermal Tumors and Ependymomas by Proteome-Wide Analysis.
de Bont JM, den Boer ML, Kros JM, Passier MM, Reddingius RE, Smitt PA, Luider TM, Pieters R.
Journal of Neuropathology and Experimental Neurology 2007 Jun; 66(6):505.
Application:IHC, Human, Brain.
-
Identification of Novel Biomarkers in Pediatric Primitive Neuroectodermal Tumors and Ependymomas by Proteome-Wide Analysis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com