ATP1B3 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ATP1B3 protein.
Immunogen
ATP1B3 (NP_001670, 1 a.a. ~ 279 a.a) full-length human protein.
Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and ATP1B3 expressing 293 cells (Green) using ATP1B3 purified MaxPab mouse polyclonal antibody.Western Blot (Cell lysate)
ATP1B3 MaxPab polyclonal antibody. Western Blot analysis of ATP1B3 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of ATP1B3 expression in transfected 293T cell line (H00000483-T01) by ATP1B3 MaxPab polyclonal antibody.
Lane 1: ATP1B3 transfected lysate(30.69 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ATP1B3
Entrez GeneID
483GeneBank Accession#
NM_001679Protein Accession#
NP_001670Gene Name
ATP1B3
Gene Alias
ATPB-3, CD298, FLJ29027
Gene Description
ATPase, Na+/K+ transporting, beta 3 polypeptide
Omim ID
601867Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq
Other Designations
Na+/K+ -ATPase beta 3 subunit|Na, K-ATPase beta-3 polypeptide|sodium/potassium-dependent ATPase beta-3 subunit|sodium/potassium-transporting ATPase beta-3 chain
-
Interactome
-
Pathway
-
Publication Reference
-
Retinoschisin is linked to retinal Na/K-ATPase signaling and localization.
Plössl K, Royer M, Bernklau S, Tavraz NN, Friedrich T, Wild J, Weber BHF, Friedrich U.
Molecular Biology of the Cell 2017 Jun; 28(16):2178.
Application:Flow Cyt, WB-Tr, Human, HEK 293 cells.
-
Retinoschisin is linked to retinal Na/K-ATPase signaling and localization.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com