RERE monoclonal antibody (M06), clone 2F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RERE.
Immunogen
RERE (NP_036234.2, 85 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RYERTDTGEITSYITEDDVVYRPGDCVYIVCRRPNTPYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RERE monoclonal antibody (M06), clone 2F2. Western Blot analysis of RERE expression in Jurkat.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RERE is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RERE on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RERE
Entrez GeneID
473GeneBank Accession#
NM_012102Protein Accession#
NP_036234.2Gene Name
RERE
Gene Alias
ARG, ARP, ATN1L, DNB1, FLJ38775, KIAA0458
Gene Description
arginine-glutamic acid dipeptide (RE) repeats
Omim ID
605226Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000001701|atrophin 2|atrophin-1 like protein|atrophin-1 related protein
-
Interactome
-
Disease
-
Publication Reference
-
A de novo variant in RERE causes autistic behavior by disrupting related genes and signaling pathway.
Qian Li, Wenbo Li, Kaiyue Hu, Yaqian Wang, Yang Li, Jiawei Xu.
Clinical Genetics 2024 Mar; 105(3):273.
Application:IF, Human, U251 cells.
-
A de novo variant in RERE causes autistic behavior by disrupting related genes and signaling pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com