RHOA monoclonal antibody (M04), clone 1B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
RHOA monoclonal antibody (M04), clone 1B12 Western Blot analysis of RHOA expression in HL-60 ( Cat # L014V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA monoclonal antibody (M04), clone 1B12.
Lane 1: RHOA transfected lysate(21.8 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RHOA on formalin-fixed paraffin-embedded human lymphoma tissue.[antibody concentration 5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RHOA is approximately 10ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RHOA on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (46.97 KDa) .
-
Specifications
Product Description
Mouse monoclonal antibody raised against a full length recombinant RHOA.
Immunogen
RHOA (AAH01360, 1 a.a. ~ 193 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Host
Mouse
Reactivity
Human
Isotype
IgG1 lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.97 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RHOA monoclonal antibody (M04), clone 1B12 Western Blot analysis of RHOA expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA monoclonal antibody (M04), clone 1B12.
Lane 1: RHOA transfected lysate(21.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RHOA on formalin-fixed paraffin-embedded human lymphoma tissue.[antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RHOA is approximately 10ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RHOA on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — RHOA
Entrez GeneID
387GeneBank Accession#
BC001360Protein Accession#
AAH01360Gene Name
RHOA
Gene Alias
ARH12, ARHA, RHO12, RHOH12
Gene Description
ras homolog gene family, member A
Omim ID
165390Gene Ontology
HyperlinkGene Summary
O
Other Designations
Aplysia ras-related homolog 12|oncogene RHO H12|small GTP binding protein RhoA
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Cellular uptake of extracellular vesicles is mediated by clathrin-independent endocytosis and macropinocytosis.
Verdera HC, Gitz-Francois JJ, Schiffelers RM, Vader P.
Journal of Controlled Release : Official Journal of the Controlled Release Society 2017 Sep; 266:100.
Application：WB-Tr, Human , HeLa cells.
-
RhoA is associated with invasion and poor prognosis in colorectal cancer.
Jeong D, Park S, Kim H, Kim CJ, Ahn TS, Bae SB, Kim HJ, Kim TH, Im J, Lee MS, Kwon HY, Baek MJ.
International Journal of Oncology 2016 Feb; 48(2):714.
Application：IHC-P, WB-Ce, Human, Colorectal Carcinoma, Caco2, Colo201, Colo205, HCT116, HT29, LoVo, SW480, SW620 cells.
-
Relationship of RhoA signaling activity with ezrin expression and its significance in the prognosis for breast cancer patients.
Ma L, Liu YP, Zhang XH, Geng CZ, Li ZH.
Chinese Medical Journal 2013 Jan; 126(2):242.
Application：WB, IHC-P, Human, MDA-MB-231 cell, breast infiltrating ductal carcinoma tissue.
-
Cellular uptake of extracellular vesicles is mediated by clathrin-independent endocytosis and macropinocytosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com