APOA1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human APOA1 protein.
Immunogen
APOA1 (NP_000030.1, 1 a.a. ~ 267 a.a) full-length human protein.
Sequence
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in mouse brain.Western Blot (Tissue lysate)
APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in human kidney.Western Blot (Cell lysate)
APOA1 MaxPab rabbit polyclonal antibody. Western Blot analysis of APOA1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of APOA1 expression in transfected 293T cell line (H00000335-T01) by APOA1 MaxPab polyclonal antibody.
Lane 1: APOA1 transfected lysate(30.80 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between APOA1 and FGA. HeLa cells were stained with anti-APOA1 rabbit purified polyclonal 1:1200 and anti-FGA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — APOA1
Entrez GeneID
335GeneBank Accession#
NM_000039Protein Accession#
NP_000030.1Gene Name
APOA1
Gene Alias
MGC117399
Gene Description
apolipoprotein A-I
Gene Ontology
HyperlinkGene Summary
This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq
Other Designations
OTTHUMP00000069346|OTTHUMP00000069347|OTTHUMP00000069348|apolipoprotein A1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
HDL is the primary transporter for carotenoids from liver to retinal pigment epithelium in transgenic ApoA-I -/-/Bco2 -/- mice.
Binxing Li, Preejith Vachali, Fu-Yen Chang, Aruna Gorusupudi, Ranganathan Arunkumar, Linjia Shi, Gregory T Rognon, Jeanne M Frederick, Paul S Bernstein.
Archives of Biochemistry and Biophysics 2021 Dec; 716:109111.
:WB-Ti, Mouse, Mouse serum.
-
HDL is the primary transporter for carotenoids from liver to retinal pigment epithelium in transgenic ApoA-I -/-/Bco2 -/- mice.