ANXA5 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ANXA5 protein.
Immunogen
ANXA5 (NP_001145.1, 1 a.a. ~ 320 a.a) full-length human protein.
Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ANXA5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in mouse liver.Western Blot (Tissue lysate)
ANXA5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in human liver.Western Blot (Cell lysate)
ANXA5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA5 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of ANXA5 expression in transfected 293T cell line (H00000308-T01) by ANXA5 MaxPab polyclonal antibody.
Lane 1: ANXA5 transfected lysate(35.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ANXA5 transfected lysate using anti-ANXA5 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ANXA5 purified MaxPab mouse polyclonal antibody (B01P) (H00000308-B01P). -
Gene Info — ANXA5
Entrez GeneID
308GeneBank Accession#
NM_001154.2Protein Accession#
NP_001145.1Gene Name
ANXA5
Gene Alias
ANX5, ENX2, PP4
Gene Description
annexin A5
Omim ID
131230Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq
Other Designations
anchorin CII|annexin 5|endonexin II|lipocortin V|placental anticoagulant protein I
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com