ANXA4 purified MaxPab rabbit polyclonal antibody (D01P)

Catalog # H00000307-D01P

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 376.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse intestine.

Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in human stomach.

Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in rat brain.

Western Blot (Tissue lysate)
Application

Western Blot (Tissue lysate)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse brain.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in K-562.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in PC-12.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in A-431.

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in Raw 264.7.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of ANXA4 expression in transfected 293T cell line (H00000307-T02) by ANXA4 MaxPab polyclonal antibody.

Lane 1: ANXA4 transfected lysate(36.10 KDa).
Lane 2: Non-transfected lysate.

  • Specification

    Product Description

    Rabbit polyclonal antibody raised against a full-length human ANXA4 protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    ANXA4 (NP_001144.1, 1 a.a. ~ 321 a.a) full-length human protein.

    Sequence

    MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

    Host

    Rabbit

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (92); Rat (93)

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Tissue lysate)

    ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse intestine.

    Western Blot (Tissue lysate)

    ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in human stomach.

    Western Blot (Tissue lysate)

    ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in rat brain.

    Western Blot (Tissue lysate)

    ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in mouse brain.

    Western Blot (Cell lysate)

    ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in K-562.

    Western Blot (Cell lysate)

    ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in PC-12.

    Western Blot (Cell lysate)

    ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in A-431.

    Western Blot (Cell lysate)

    ANXA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of ANXA4 expression in Raw 264.7.

    Western Blot (Transfected lysate)

    Western Blot analysis of ANXA4 expression in transfected 293T cell line (H00000307-T02) by ANXA4 MaxPab polyclonal antibody.

    Lane 1: ANXA4 transfected lysate(36.10 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — ANXA4

    Entrez GeneID

    307

    GeneBank Accession#

    NM_001153.2

    Protein Accession#

    NP_001144.1

    Gene Name

    ANXA4

    Gene Alias

    ANX4, DKFZp686H02120, MGC75105, PIG28, ZAP36

    Gene Description

    annexin A4

    Omim ID

    106491

    Gene Ontology

    Hyperlink

    Gene Summary

    Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq

    Other Designations

    annexin IV|annexin IV (placental anticoagulant protein II)|placental anticoagulant protein II|proliferation-inducing gene 28|proliferation-inducing protein 28

  • Interactome
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All