AK1 monoclonal antibody (M06), clone 3A6-1F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant AK1.
Immunogen
AK1 (AAH01116, 1 a.a. ~ 194 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (88); Rat (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AK1 monoclonal antibody (M06), clone 3A6-1F5 Western Blot analysis of AK1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of AK1 expression in transfected 293T cell line by AK1 monoclonal antibody (M06), clone 3A6-1F5.
Lane 1: AK1 transfected lysate(21.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of AK1 transfected lysate using anti-AK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AK1 MaxPab rabbit polyclonal antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of AK1 over-expressed 293 cell line, cotransfected with AK1 Validated Chimera RNAi ( Cat # H00000203-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AK1 monoclonal antibody (M06), clone 3A6-1F5 (Cat # H00000203-M06 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to AK1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — AK1
Entrez GeneID
203GeneBank Accession#
BC001116Protein Accession#
AAH01116Gene Name
AK1
Gene Alias
-
Gene Description
adenylate kinase 1
Omim ID
103000Gene Ontology
HyperlinkGene Summary
Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. [provided by RefSeq
Other Designations
ATP-AMP transphosphorylase|OTTHUMP00000022217|OTTHUMP00000022218|myokinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com