ACP1 monoclonal antibody (M06), clone 2A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ACP1.
Immunogen
ACP1 (AAH07422, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (81)
Isotype
IgG
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.12 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
ACP1 monoclonal antibody (M06), clone 2A3. Western Blot analysis of ACP1 expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ACP1 expression in transfected 293T cell line by ACP1 monoclonal antibody (M06), clone 2A3.
Lane 1: ACP1 transfected lysate(18 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACP1 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — ACP1
Entrez GeneID
52GeneBank Accession#
BC007422Protein Accession#
AAH07422Gene Name
ACP1
Gene Alias
HAAP, MGC111030, MGC3499
Gene Description
acid phosphatase 1, soluble
Omim ID
171500Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
acid phosphatase of erythrocyte|adipocyte acid phosphatase|cytoplasmic phosphotyrosyl protein phosphatase|low molecular weight phosphotyrosine protein phosphatase|protein tyrosine phosphatase|red cell acid phosphatase 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com