CALR3 monoclonal antibody (M01), clone 4E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CALR3 expression in transfected 293T cell line by CALR3 monoclonal antibody (M01), clone 4E3.
Lane 1: CALR3 transfected lysate(45 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CALR3 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of CALR3 over-expressed 293 cell line, cotransfected with CALR3 Validated Chimera RNAi ( Cat # H00125972-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CALR3 monoclonal antibody (M01), clone 4E3 (Cat # H00125972-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (65.78 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CALR3.
Immunogen
CALR3 (AAH14595, 21 a.a. ~ 384 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (84)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (65.78 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CALR3 expression in transfected 293T cell line by CALR3 monoclonal antibody (M01), clone 4E3.
Lane 1: CALR3 transfected lysate(45 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CALR3 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CALR3 over-expressed 293 cell line, cotransfected with CALR3 Validated Chimera RNAi ( Cat # H00125972-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CALR3 monoclonal antibody (M01), clone 4E3 (Cat # H00125972-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CALR3
Entrez GeneID
125972GeneBank Accession#
BC014595Protein Accession#
AAH14595Gene Name
CALR3
Gene Alias
CRT2, FLJ25355, MGC26577
Gene Description
calreticulin 3
Omim ID
611414Gene Ontology
HyperlinkGene Summary
Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum Persson et al. (2002) [PubMed 12384296].[supplied by OMIM
Other Designations
calreticulin 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com