AASDHPPT purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human AASDHPPT protein.
Immunogen
AASDHPPT (NP_056238.2, 1 a.a. ~ 309 a.a) full-length human protein.
Sequence
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPEDPSFWDCFCFTEEIPIRNGTKS
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AASDHPPT MaxPab polyclonal antibody. Western Blot analysis of AASDHPPT expression in Jurkat.Western Blot (Cell lysate)
AASDHPPT MaxPab polyclonal antibody. Western Blot analysis of AASDHPPT expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of AASDHPPT expression in transfected 293T cell line (H00060496-T01) by AASDHPPT MaxPab polyclonal antibody.
Lane 1: AASDHPPT transfected lysate(33.99 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AASDHPPT
Entrez GeneID
60496GeneBank Accession#
NM_015423.2Protein Accession#
NP_056238.2Gene Name
AASDHPPT
Gene Alias
AASD-PPT, CGI-80, DKFZp566E2346, LYS2, LYS5
Gene Description
aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
Omim ID
607756Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq
Other Designations
4'-phosphopantetheinyl transferase|alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com