SALL4 monoclonal antibody (M03J), clone 6E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SALL4 monoclonal antibody (M03J), clone 6E3. Western Blot analysis of SALL4 expression in NIH/3T3.
Western Blot (Cell lysate)
SALL4 monoclonal antibody (M03J), clone 6E3. Western Blot analysis of SALL4 expression in Hela S3 NE.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SALL4 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SALL4.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (71); Rat (71)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SALL4 monoclonal antibody (M03J), clone 6E3. Western Blot analysis of SALL4 expression in NIH/3T3.Western Blot (Cell lysate)
SALL4 monoclonal antibody (M03J), clone 6E3. Western Blot analysis of SALL4 expression in Hela S3 NE.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SALL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SALL4 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — SALL4
Entrez GeneID
57167GeneBank Accession#
NM_020436Protein Accession#
NP_065169Gene Name
SALL4
Gene Alias
DRRS, HSAL4, MGC133050, ZNF797, dJ1112F19.1
Gene Description
sal-like 4 (Drosophila)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). [provided by RefSeq
Other Designations
OTTHUMP00000031296|sal-like 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com