RAD18 monoclonal antibody (M01), clone 3H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAD18.
Immunogen
RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (65); Rat (76)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAD18 monoclonal antibody (M01), clone 3H7 Western Blot analysis of RAD18 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
RAD18 monoclonal antibody (M01), clone 3H7. Western Blot analysis of RAD18 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of RAD18 expression in transfected 293T cell line by RAD18 monoclonal antibody (M01), clone 3H7.
Lane 1: RAD18 transfected lysate(56.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to RAD18 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAD18 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RAD18 over-expressed 293 cell line, cotransfected with RAD18 Validated Chimera RNAi ( Cat # H00056852-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD18 monoclonal antibody (M01), clone 3H7 (Cat # H00056852-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 25 ug/ml] -
Gene Info — RAD18
Entrez GeneID
56852GeneBank Accession#
NM_020165Protein Accession#
NP_064550Gene Name
RAD18
Gene Alias
RNF73
Gene Description
RAD18 homolog (S. cerevisiae)
Omim ID
605256Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens. [provided by RefSeq
Other Designations
RAD18, S. cerevisiae, homolog|postreplication repair protein hRAD18p
-
Interactome
-
Disease
-
Publication Reference
-
The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks.
Sy SM, Jiang J, O WS, Deng Y, Huen MS.
Nucleic Acids Research 2013 Oct; 41(18):8572.
Application:IF, Human, HeLa cells.
-
Phosphorylation of human INO80 is involved in DNA damage tolerance.
Kato D, Waki M, Umezawa M, Aoki Y, Utsugi T, Ohtsu M, Murakami Y.
Biochemical and Biophysical Research Communications 2012 Jan; 417(1):433.
Application:IF, WB-Tr, Human, HeLa cells.
-
Elevated expression of Rad18 regulates melanoma cell proliferation.
Wong RP, Aguissa-Toure AH, Wani AA, Khosravi S, Martinka M, Martinka M, Li G.
Pigment Cell & Melanoma Research 2012 Jan; 25(2):213.
Application:IHC, WB, Human, Human melanoma, HSR-GBM1 cells, Melanocytes, MEWO, MMAN, MMLH, MMRU, PMWK, RPEP, RPM-MC, SK-mel-3, SK-mel-110 cells.
-
NBS1 Recruits RAD18 via a RAD6-like Domain and Regulates Pol ?b-Dependent Translesion DNA Synthesis.
Yanagihara H, Kobayashi J, Tateishi S, Kato A, Matsuura S, Tauchi H, Yamada K, Takezawa J, Sugasawa K, Masutani C, Hanaoka F, Weemaes CM, Mori T, Zou L, Komatsu K.
Molecular Cell 2011 Sep; 43(5):788.
Application:IP, WB, Human, 293E cells.
-
Tumour suppressor ING1b maintains genomic stability upon replication stress.
Wong RP, Lin H, Khosravi S, Piche B, Jafarnejad SM, Chen DW, Li G.
Nucleic Acids Research 2011 May; 39(9):3632.
Application:WB, Human, HCT116 cells.
-
WRN participates in translesion synthesis pathway through interaction with NBS1.
Kobayashi J, Okui M, Asaithamby A, Burma S, Chen BP, Tanimoto K, Matsuura S, Komatsu K, Chen DJ.
Mechanisms of Ageing and Development 2010 Jun; 131(6):436.
Application:IF, IP, WB, Human, WS cells.
-
Differential roles for DNA Polymerases Eta, Zeta and REV1 in lesion bypass of intrastrand versus interstrand DNA cross-links.
Hicks JK, Chute CL, Paulsen MT, Ragland RL, Howlett NG, Gueranger Q, Glover TW, Canman CE.
Molecular and Cellular Biology 2010 Mar; 30(5):1217.
Application:IF, WB-Tr, Human, HeLa cells.
-
The ubiquitin specific protease USP34 promotes ubiquitin signaling at DNA double-strand breaks.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com