BCAP29 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human BCAP29 protein.
Immunogen
BCAP29 (NP_061332.2, 1 a.a. ~ 241 a.a) full-length human protein.
Sequence
MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREVRKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (82); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in human pancreas.Western Blot (Tissue lysate)
BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in rat brain.Western Blot (Tissue lysate)
BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in mouse liver.Western Blot (Tissue lysate)
BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in mouse testis.Western Blot (Tissue lysate)
BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in human placenta.Western Blot (Cell lysate)
BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in PC-12.Western Blot (Cell lysate)
BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in HepG2.Western Blot (Cell lysate)
BCAP29 MaxPab rabbit polyclonal antibody. Western Blot analysis of BCAP29 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of BCAP29 expression in transfected 293T cell line (H00055973-T01) by BCAP29 MaxPab polyclonal antibody.
Lane 1: BCAP29 transfected lysate(28.30 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of BCAP29 transfected lysate using anti-BCAP29 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with BCAP29 purified MaxPab mouse polyclonal antibody (B01P) (H00055973-B01P). -
Gene Info — BCAP29
Entrez GeneID
55973GeneBank Accession#
NM_018844Protein Accession#
NP_061332.2Gene Name
BCAP29
Gene Alias
BAP29, DKFZp686M2086
Gene Description
B-cell receptor-associated protein 29
Gene Ontology
HyperlinkOther Designations
B-cell receptor-associated protein BAP29
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com