WDR79 monoclonal antibody (M04), clone 1F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WDR79.
Immunogen
WDR79 (NP_060551.1, 62 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WDR79 monoclonal antibody (M04), clone 1F12. Western Blot analysis of WDR79 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDR79 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to WDR79 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — WDR79
Entrez GeneID
55135GeneBank Accession#
NM_018081Protein Accession#
NP_060551.1Gene Name
WDR79
Gene Alias
FLJ10385, WRAP53
Gene Description
WD repeat domain 79
Gene Ontology
HyperlinkOther Designations
WD40 protein Wrap53
-
Interactome
-
Disease
-
Publication Reference
-
Persistent accumulation of unrepaired DNA damage in rat cortical neurons: nuclear organization and ChIP-seq analysis of damaged DNA.
Mata-Garrido J, Tapia O, Casafont I, Berciano MT, Cuadrado A, Lafarga M.
Acta Neuropathologica Communications 2018 Jul; 6(1):68.
Application:IF, Rat, Cortical neurons.
-
Splicing controls the ubiquitin response during DNA double-strand break repair.
Pederiva C, Bohm S, Julner A, Farnebo M.
Cell Death and Differentiation 2016 Oct; 23(10):1648.
Application:IF, Human, U2OS cells.
-
Overexpression of the scaffold WD40 protein WRAP53β enhances the repair of and cell survival from DNA double-strand breaks.
Rassoolzadeh H, Bohm S, Hedstrom E, Gad H, Helleday T, Henriksson S, Farnebo M.
Cell Death & Disease 2016 Jun; 7:e2267.
Application:WB-Tr, Human, U2OS cells.
-
Neuronal accumulation of unrepaired DNA in a novel specific chromatin domain: structural, molecular and transcriptional characterization.
Mata-Garrido J, Casafont I, Tapia O, Berciano MT, Lafarga M.
Acta Neuropathologica Communications 2016 Apr; 4:41.
Application:IEM, IF, WB-Ce, Rat, Sensory ganglion neurons.
-
The scaffold protein WRAP53β orchestrates the ubiquitin response critical for DNA double-strand break repair.
Henriksson S, Rassoolzadeh H, Hedstrom E, Coucoravas C, Julner A, Goldstein M, Imreh G, Zhivotovsky B, Kastan MB, Helleday T, Farnebo M.
Genes & Development 2014 Dec; 28(24):2726.
Application:IF, Human, U2OS cells.
-
Persistent accumulation of unrepaired DNA damage in rat cortical neurons: nuclear organization and ChIP-seq analysis of damaged DNA.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com