DNAJC10 monoclonal antibody (M02), clone 3A8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DNAJC10.
Immunogen
DNAJC10 (NP_061854, 688 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
DNAJC10 monoclonal antibody (M02), clone 3A8. Western Blot analysis of DNAJC10 expression in human kidney.Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M02), clone 3A8. Western Blot analysis of DNAJC10 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M02), clone 3A8. Western Blot analysis of DNAJC10 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M02), clone 3A8. Western Blot analysis of DNAJC10 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
DNAJC10 monoclonal antibody (M02), clone 3A8. Western Blot analysis of DNAJC10 expression in NIH/3T3 ( Cat # L018V1 ).Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DNAJC10 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — DNAJC10
Entrez GeneID
54431GeneBank Accession#
NM_018981Protein Accession#
NP_061854Gene Name
DNAJC10
Gene Alias
DKFZp434J1813, ERdj5, JPDI, MGC104194
Gene Description
DnaJ (Hsp40) homolog, subfamily C, member 10
Omim ID
607987Gene Ontology
HyperlinkGene Summary
subfamily C
Other Designations
ER-resident protein ERdj5|J-domain-containing protein disulfide isomerase-like protein|macrothioredoxin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com