RNF141 monoclonal antibody (M01), clone 6D9

Catalog # H00050862-M01

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RNF141 monoclonal antibody (M01), clone 6D9. Western Blot analysis of RNF141 expression in Raw 264.7 ( Cat # L024V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RNF141 monoclonal antibody (M01), clone 6D9. Western Blot analysis of RNF141 expression in PC-12 ( Cat # L012V1 ).

Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

RNF141 monoclonal antibody (M01), clone 6D9 Western Blot analysis of RNF141 expression in A-431 ( Cat # L015V1 ).

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of RNF141 expression in transfected 293T cell line by RNF141 monoclonal antibody (M01), clone 6D9.

Lane 1: RNF141 transfected lysate(25.5 KDa).
Lane 2: Non-transfected lysate.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Application

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

Immunoperoxidase of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3 ug/ml]

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged RNF141 is approximately 0.03ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of RNF141 over-expressed 293 cell line, cotransfected with RNF141 Validated Chimera RNAi ( Cat # H00050862-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF141 monoclonal antibody (M01), clone 6D9 (Cat # H00050862-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (35.53 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant RNF141.

    Immunogen

    RNF141 (NP_001008563, 141 a.a. ~ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHR

    Host

    Mouse

    Reactivity

    Human, Mouse, Rat

    Interspecies Antigen Sequence

    Mouse (99); Rat (98)

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (35.53 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    RNF141 monoclonal antibody (M01), clone 6D9. Western Blot analysis of RNF141 expression in Raw 264.7 ( Cat # L024V1 ).

    Western Blot (Cell lysate)

    RNF141 monoclonal antibody (M01), clone 6D9. Western Blot analysis of RNF141 expression in PC-12 ( Cat # L012V1 ).

    Western Blot (Cell lysate)

    RNF141 monoclonal antibody (M01), clone 6D9 Western Blot analysis of RNF141 expression in A-431 ( Cat # L015V1 ).

    Western Blot (Transfected lysate)

    Western Blot analysis of RNF141 expression in transfected 293T cell line by RNF141 monoclonal antibody (M01), clone 6D9.

    Lane 1: RNF141 transfected lysate(25.5 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)

    Immunoperoxidase of monoclonal antibody to RNF141 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.3 ug/ml]

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged RNF141 is approximately 0.03ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of RNF141 over-expressed 293 cell line, cotransfected with RNF141 Validated Chimera RNAi ( Cat # H00050862-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF141 monoclonal antibody (M01), clone 6D9 (Cat # H00050862-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — RNF141

    Entrez GeneID

    50862

    GeneBank Accession#

    NM_016422

    Protein Accession#

    NP_001008563

    Gene Name

    RNF141

    Gene Alias

    MGC8715, ZFP26, ZNF230

    Gene Description

    ring finger protein 141

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis. [provided by RefSeq

    Other Designations

    C3HC4-like zinc finger protein

  • Interactome
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All