RACGAP1 monoclonal antibody (M01), clone 1G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RACGAP1.
Immunogen
RACGAP1 (AAH32754, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (84)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RACGAP1 monoclonal antibody (M01), clone 1G6. Western Blot analysis of RACGAP1 expression in 293 ( Cat # L026V1 ).Western Blot (Cell lysate)
RACGAP1 monoclonal antibody (M01), clone 1G6. Western Blot analysis of RACGAP1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RACGAP1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — RACGAP1
Entrez GeneID
29127GeneBank Accession#
BC032754Protein Accession#
AAH32754Gene Name
RACGAP1
Gene Alias
HsCYK-4, ID-GAP, MgcRacGAP
Gene Description
Rac GTPase activating protein 1
Omim ID
604980Gene Ontology
HyperlinkGene Summary
Rho GTPases control a variety of cellular processes. There are 3 subtypes of Rho GTPases in the Ras superfamily of small G proteins: RHO (see MIM 165370), RAC (see RAC1; MIM 602048), and CDC42 (MIM 116952). GTPase-activating proteins (GAPs) bind activated forms of Rho GTPases and stimulate GTP hydrolysis. Through this catalytic function, Rho GAPs negatively regulate Rho-mediated signals. GAPs may also serve as effector molecules and play a role in signaling downstream of Rho and other Ras-like GTPases.[supplied by OMIM
Other Designations
GTPase activating protein
-
Interactome
-
Disease
-
Publication Reference
-
Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-activating Proteins in Basal-like Breast Cancers.
Lawson CD, Fan C, Mitin N, Baker NM, George SD, Graham DM, Perou CM, Burridge K, Der CJ, Rossman KL.
Cancer Research 2016 Jul; 76(13):3826.
Application:WB-Ce, WB-Tr, Human, HMLE, HCC1937, MCF-10A, MCF-7, MDA-MB-231, MDA-MB-468, SUM159, SUM149 cells.
-
RNA-seq identification of RACGAP1 as a metastatic driver in uterine carcinosarcoma.
Mi S, Lin M, Brouwer-Visser J, Heim J, Smotkin D, Hebert TM, Gunter MJ, Goldberg GL, Zheng D, Huang GS.
Clinical Cancer Research 2016 Sep; 22(18):4676.
Application:IHC, WB-Ti, WB-Tr, Human, Uterine carcinosarcoma, CS99 cells.
-
Centralspindlin links the mitotic spindle to the plasma membrane during cytokinesis.
Lekomtsev S, Su KC, Pye VE, Blight K, Sundaramoorthy S, Takaki T, Collinson LM, Cherepanov P, Divecha N, Petronczki M.
Nature 2012 Dec; 492(7428):276.
Application:IF, Human, Chicken, HeLa, DT40 cells.
-
Up-regulation of Rac GTPase activating protein 1 is significantly associated with the early recurrence of human hepatocellular carcinoma.
Wang SM, Ooi LL, Hui KM.
Clinical Cancer Research 2011 Sep; 17(18):6040.
Application:IHC-Fr, WB, Human, HepG2, Hep3B, MHCC97H cells, Hepatocellular carcinoma.
-
Polo-Like Kinase 1 Directs Assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF Complex to Initiate Cleavage Furrow Formation.
Wolfe BA, Takaki T, Petronczki M, Glotzer M.
PLoS Biology 2009 May; 7(5):e1000110.
Application:WB-Ce, WB-Tr, Human, HeLa cells.
-
Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells.
Burkard ME, Maciejowski J, Rodriguez-Bravo V, Repka M, Lowery DM, Clauser KR, Zhang C, Shokat KM, Carr SA, Yaffe MB, Jallepalli PV.
PLoS Biology 2009 May; 7(5):e1000111.
Application:WB-Ce, Human, HeLa cells.
-
Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-activating Proteins in Basal-like Breast Cancers.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com