NKIRAS2 monoclonal antibody (M02), clone 2G9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NKIRAS2 monoclonal antibody (M02), clone 2G9 Western Blot analysis of NKIRAS2 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NKIRAS2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NKIRAS2 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (46.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NKIRAS2.
Immunogen
NKIRAS2 (AAH07450, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NKIRAS2 monoclonal antibody (M02), clone 2G9 Western Blot analysis of NKIRAS2 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NKIRAS2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NKIRAS2 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — NKIRAS2
Entrez GeneID
28511GeneBank Accession#
BC007450Protein Accession#
AAH07450Gene Name
NKIRAS2
Gene Alias
DKFZp434N1526, KBRAS2, MGC74742, kappaB-Ras2
Gene Description
NFKB inhibitor interacting Ras-like 2
Omim ID
604497Gene Ontology
HyperlinkOther Designations
I-kappa-B-interacting Ras-like protein 2|NFKB inhibitor interacting Ras-like protein 2|OTTHUMP00000164764|OTTHUMP00000164765
-
Interactome
-
Disease
-
Publication Reference
-
Estradiol suppresses NF-kappaB activation through coordinated regulation of let-7a and miR-125b in primary human macrophages.
Murphy AJ, Guyre PM, Pioli PA.
Journal of Immunology 2010 May; 184(9):5029.
Application：WB-Ce, Human, Human macrophages.
-
Estradiol suppresses NF-kappaB activation through coordinated regulation of let-7a and miR-125b in primary human macrophages.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com